PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 503aa    MW: 56371.1 Da    PI: 6.02
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13595.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.21.1e-88714922373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal............klfsevsP 89 
                ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRl++ f++AL +r ar ++++ k l++  + +++ +++l+++             +f +++P
  PK13595.1  71 EQLLVHCANAIETNDVTLAQQILWVLNNIAQPDGDSNQRLTSAFLRALITRAARIGTSCIKMLASAVAVQTQNDDNLNVVfdvphrfsvidfATFIDLTP 170
                79****************************************************9999999886666665665555555556666666666567****** PP

       GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvl. 181
                +++f++ +aN aIleaveg + +H +D++ ++++Q p+Ll+a+asR  e +p +++T+v+++e++         ++ e+g +L +fA++ ++ +ef+++ 
  PK13595.1 171 WHRFGFTAANAAILEAVEGFSVIHLVDLSSTHCMQIPTLLDAIASRHyEVTPVIKLTVVVAAEANdvvppiLDISYDELGLKLVNFARSRNIILEFRLVh 270
                ***********************************************8889*********9888889998888999**********************85 PP

       GRAS 182 ..vakrledleleeLrvkp..............gEalaVnlvlqlhrll................desvsleserdevLklvkslsPkvvvvveqeadhn 249
                  +++ +++l +e+Lr+++               Eal++n++++lh+++                + s s++s r+ +Lk ++sl P+vvv+v+++ad++
  PK13595.1 271 stYSDGFASL-IEHLRLQQqqylvnnnhnyeitPEALVINCHMMLHYIPeetlinsnnnnndndiNCSSSSSSLRSMFLKSIRSLDPNVVVLVDEDADLT 369
                5523333333.56666655556666789999999***************************999966677777888************************ PP

       GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                s++++ r+ +a+++ +  +d++e+ lp+ s++r+++E+  +g++i+nv+a+eg +r+er e +++W +r+++a F++v ++e+a++++k++l +++  g+
  PK13595.1 370 SNNLVCRLRSAFNFLWIPYDTVETFLPKGSKQRQWYEAD-IGWKIENVIANEGVQRVERLEPKSRWVQRMRNASFRSVGFGEEAVSEVKTMLDEHA-AGW 467
                ***************************************.********************************************************.556 PP

       GRAS 350 rve.eesgslvlgWkdrpLvsvSaW 373
                 ++ e+++ lvl+Wk++++v+++ W
  PK13595.1 468 GLKkEDEDHLVLTWKGHNVVFATLW 492
                66536788999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.57744473IPR005202Transcription factor GRAS
PfamPF035143.9E-8671492IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MMQFTTTSTT PTPTTTTITP PNIPPILLCN NLPIMNKTQL NRGHHHHRPW PGGFPTSKAL  60
GTSFGDANCM EQLLVHCANA IETNDVTLAQ QILWVLNNIA QPDGDSNQRL TSAFLRALIT  120
RAARIGTSCI KMLASAVAVQ TQNDDNLNVV FDVPHRFSVI DFATFIDLTP WHRFGFTAAN  180
AAILEAVEGF SVIHLVDLSS THCMQIPTLL DAIASRHYEV TPVIKLTVVV AAEANDVVPP  240
ILDISYDELG LKLVNFARSR NIILEFRLVH STYSDGFASL IEHLRLQQQQ YLVNNNHNYE  300
ITPEALVINC HMMLHYIPEE TLINSNNNNN DNDINCSSSS SSLRSMFLKS IRSLDPNVVV  360
LVDEDADLTS NNLVCRLRSA FNFLWIPYDT VETFLPKGSK QRQWYEADIG WKIENVIANE  420
GVQRVERLEP KSRWVQRMRN ASFRSVGFGE EAVSEVKTML DEHAAGWGLK KEDEDHLVLT  480
WKGHNVVFAT LWMPASVALT TTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-13724926374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491939.10.0PREDICTED: scarecrow-like protein 32 isoform X1
SwissprotQ9SN221e-176SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A061DGZ90.0A0A061DGZ9_THECC; SCL domain class transcription factor
STRINGGLYMA05G22140.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-177GRAS family protein